Gins4 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Gins4, Each
$ 1,757.70
|
|
Details
The yeast heterotetrameric gins complex is made up of sld5, psf1 (gins1; mim 610608), psf2 (gins2; mim 610609), and psf3 (gins3; mim 610610). The formation of the gins complex is essential for the initiation of dna replication in yeast and xenopus egg extracts (ueno et al., 2005 [Pubmed 16287864]). See gins1 for additional information about the gins complex.[Supplied by omimsequence: mteevdflgqdsdggseevvltpaelierleqawmnekfapelleskpeivecvmeqlehmee
Additional Information
| SKU | 10287906 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB21736 |
