Ggct Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Ggct, Each
$ 1,757.70
|
|
Details
Ggct (ec 2.3.2.4) Catalyzes the formation of 5-oxoproline (pyroglutamic acid) from gamma-glutamyl dipeptides and may play a significant role in glutathione homeostasis (oakley et al., 2008 [Pubmed 18515354]).[Supplied by omimsequence: qegvksgmyvvievkvatqegkeitcrsylmtnyesappspqykkiicmgakenglpleyqeklkaiepndytgkvseeie
Additional Information
| SKU | 10287538 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB21330 |
