Gcs1 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Gcs1, Each
$ 1,757.70
|
|
Details
This gene encodes the first enzyme in the n-linked oligosaccharide processing pathway. The enzyme cleaves the distal alpha-1,2-linked glucose residue from the glc(3)-man(9)-glcnac(2) oligosaccharide precursor. This protein is located in the lumen of the endoplasmic reticulum. Defects in this gene are a cause of type iib congenital disorder of glycosylation (cdgiib). Two transcript variants encoding different isoforms have been found for this gene. [Provided by refseqsequence: leshaegfrerfektfqlkekglssgeqvlgqaalsgllggigyfygqglvlpdigvegseqkvdpalfppvplftavpsrsffprgflwdegfhqlvvqrwdpsltrealghwlgllnadgwig
Additional Information
| SKU | 10286892 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB20575 |
