Gcc2, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Gcc2, Each
$ 1,757.70
|
|
Details
The protein encoded by this gene is a peripheral membrane protein localized to the trans-golgi network. It is sensitive to brefeldin a. This encoded protein contains a grip domain which is thought to be used in targeting. Alternative splicing results in multiple transcript variants. [Provided by refseqsequence: qniseansqhyqkninslqeellqlkaihqeevkelmcqieasakeheaeinklnelkenlvkqceasekniqkkyecelenlrkatsnanqdnqicsil
Additional Information
| SKU | 10288911 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB22917 |
