518-831-8000 sales@utechproducts.com

Gcat, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Gcat, Each

1,757.70

Details

The degradation of l-threonine to glycine consists of a two-step biochemical pathway involving the enzymes l-threonine dehydrogenase and 2-amino-3-ketobutyrate coenzyme a ligase. L-threonine is first converted into 2-amino-3-ketobutyrate by l-threonine dehydrogenase. This gene encodes the second enzyme in this pathway, which then catalyzes the reaction between 2-amino-3-ketobutyrate and coenzyme a to form glycine and acetyl-coa. The encoded enzyme is considered a class ii pyridoxal-phosphate-dependent aminotransferase. [Provided by refseqsequence: clasrygalvfmdechatgflgptgrgtdellgvmdqvtiinstlgkalggasggyttgpgplvsllrqrarpylfsnslppavvgcaskaldllmgsntivqsmaaktqrfrskmeaagftisga

Additional Information

SKU 10287516
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21302