Gabbr2 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Gabbr2, Each
$ 1,757.70
|
|
Details
B-type receptors for the neurotransmitter gaba (gamma-aminobutyric acid) inhibit neuronal activity through g protein-coupled second-messenger systems, which regulate the release of neurotransmitters and the activity of ion channels and adenylyl cyclase. See gabbr1 (mim 603540) for additional background information on gaba-b receptors.[Supplied by omimsequence: sktstsvtsvnqastsrleglqsenhrlrmkiteldkdleevtmqlqdtpekttyikqnhyqelndilnlgnftestdggkailknhldqnpqlqwnttepsrtckdpiedinspehiqrrlslqlpi
Additional Information
| SKU | 10286974 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB20675 |
