518-831-8000 sales@utechproducts.com

FOXN2, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant FOXN2, Each

1,069.20

Details:

This gene encodes a forkhead domain binding protein and may function in the transcriptional regulation of the human T-cell leukemia virus long terminal repeat. [provided by RefSeqSequence: LSLNKCFQKVERSHGKVNGKGSLWCVDPEYKPNLIQALKKQPFSSASSQNGSLSPHYLSSVIKQNQVRNLKESDIDAAAAMMLLNTSIEQGILECEKPLPLKTALQKKRSYGNAFHHPSAVRLQESDSLATSIDPKEDHNYSA

Additional Information

SKU 10286579
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20217