Fez2 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Fez2, Each
$ 1,757.70
|
|
Details
This gene is an ortholog of the c. Elegans unc-76 gene, which is necessary for normal axonal bundling and elongation within axon bundles. Other orthologs include the rat gene that encodes zygin ii, which can bind to synaptotagmin. [Provided by refseqsequence: gsyeervkrlsvselneileeietaikeyseelvqqlalrdelefekevknsfisvlievqnkqkehketakkkkklkngssqngknershmpgtylttvipyekkngppsvedlqiltkilramkedsekvpslltdyil
Additional Information
| SKU | 10288929 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB22936 |
