Fcer1g, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Fcer1g, Each
$ 1,757.70
|
|
Details
The high affinity ige receptor is a key molecule involved in allergic reactions. It is a tetramer composed of 1 alpha, 1 beta, and 2 gamma chains. The gamma chains are also subunits of other fc receptors. [Provided by refseqsequence: kiqvrkaaitsyeksdgvytglstrnqetyetlkhekppq
Additional Information
| SKU | 10288005 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB21846 |
