Fbxo8, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Fbxo8, Each
|
|
Details
This gene encodes a member of the f-box protein family which is characterized by an approximately 40 amino acid motif, the f-box. The f-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called scfs (skp1-cullin-f-box), which function in phosphorylation-dependent ubiquitination. The f-box proteins are divided into 3 classes: fbws containing wd-40 domains, fbls containing leucine-rich repeats, and fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the fbxs class. It contains a c-terminal amino acid sequence that bears a significant similarity with a portion of yeast sec7p, a critical regulator of vesicular protein transport. This human protein may interact with adp-ribosylation factor(s)(arfs) and exhibit arf-gef (guanine nucleotide exchange factor) activity. [Provided by refseq]sequence: wrvvrnqqlqqegyseqgyltreqsrrmaasnisntnhrkqvqggidiyhllkarkskeqegfinlemlppelsftilsylnatdlclascvwqdlandellwqglckstwghcsiynknpplgfsfrklymq
Additional Information
| SKU | 10292448 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB28605 |
