518-831-8000 sales@utechproducts.com

Fbxo18, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Fbxo18, Each

1,757.70

Details

This gene encodes a member of the f-box protein family, members of which are characterized by an approximately 40 amino acid motif, the f-box. The f-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called scfs (skp1-cullin-f-box), which function in phosphorylation-dependent ubiquitination. The f-box proteins are divided into three classes: fbws containing wd-40 domains, fbls containing leucine-rich repeats, and fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the fbx class. It contains an f-box motif and seven conserved helicase motifs, and has both dna-dependent atpase and dna unwinding activities. Alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. [Provided by refseq]sequence: hqmthdgylklwqlskpslasfdaifvdeaqdctpaimnivlsqpcgkifvgdphqqiytfrgavnalftvphthvfyltqsfrfgveiayvgatildvckrvrkktlvggnhqsgirgdak

Additional Information

SKU 10286499
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20133