518-831-8000 sales@utechproducts.com

Fads2, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Fads2, Each

1,757.70

Details

The protein encoded by this gene is a member of the fatty acid desaturase (fads) gene family. Desaturase enzymes regulate unsaturation of fatty acids through the introduction of double bonds between defined carbons of the fatty acyl chain. Fads family members are considered fusion products composed of an n-terminal cytochrome b5-like domain and a c-terminal multiple membrane-spanning desaturase portion, both of which are characterized by conserved histidine motifs. This gene is clustered with family members fads1 and fads2 at 11q12-q13.1; This cluster is thought to have arisen evolutionarily from gene duplication based on its similar exon/intron organization. [Provided by refseqsequence: gkggnqgegaaerevsvptfsweeiqkhnlrtdrwlvidrkvynitkwsiqhpggqrvighyagedatdafrafhpdlefvgkflkplligelapeepsqdhgknskitedfralrktaedmnlfktnh

Additional Information

SKU 10286692
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20354