Etfdh, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Etfdh, Each
$ 1,757.70
|
|
Details
Electron-transferring-flavoprotein dehydrogenase in the inner mitochondrial membrane accepts electrons from electron-transfer flavoprotein which is located in the mitochondrial matrix and reduces ubiquinone in the mitochondrial membrane. The protein is synthesized as a 67kda precursor which is targeted to mitochondria and processed in a single step to a 64kda mature form located in the mitochondrial membrane. Deficiency in electron-transferring-flavoprotein dehydrogenase have been demonstrated in some patients with type ii glutaricacidemia. [Provided by refseqsequence: lavahekdirvclvekaaqigahtlsgacldpgafkelfpdwkekgaplntpvtedrfgiltekyripvpilpglpmn
Additional Information
| SKU | 10289765 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB23884 |
