Ergic1 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Ergic1, Each
$ 1,757.70
|
|
Details
This gene encodes a cycling membrane protein which is an endoplasmic reticulum-golgi intermediate compartment (ergic) protein which interacts with other members of this protein family to increase their turnover. [Provided by refseqsequence: vvnelyvddpdkdsggkidvslnislpnlhcelvgldiqdemgrhevghidnsmkiplnngagcrfegqfsink
Additional Information
| SKU | 10287403 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB21171 |
