518-831-8000 sales@utechproducts.com

Ep300 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Ep300, Each

1,433.70

Details

This gene encodes the adenovirus e1a-associated cellular p300 transcriptional co-activator protein. It functions as histone acetyltransferase that regulates transcription via chromatin remodeling and is important in the processes of cell proliferation and differentiation. It mediates camp-gene regulation by binding specifically to phosphorylated creb protein. This gene has also been identified as a co-activator of hif1a (hypoxia-inducible factor 1 alpha), and thus plays a role in the stimulation of hypoxia-induced genes such as vegf. Defects in this gene are a cause of rubinstein-taybi syndrome and may also play a role in epithelial cancer. [Provided by refseqsequence: flpqtqfpsqgmnvtniplapssgqapvsqaqmsssscpvnspimppgsqgshihcpqlpqpalhqnspspvpsrtptphhtppsigaqqppattipapvptppamppgpqsqalhppprqtptppttqlpqq

Additional Information

SKU 10292573
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28738