Entpd5, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Entpd5, Each
$ 1,757.70
|
|
Details
The protein encoded by this gene is similar to e-type nucleotidases (ntpases)/ecto-atpase/apyrases. Ntpases, such as cd39, mediate catabolism of extracellular nucleotides. Entpd5 contains 4 apyrase-conserved regions which is characteristic of ntpases. [Provided by refseqsequence: agstgtrihvytfvqkmpgqlpilegevfdsvkpglsafvdqpkqgaetvqgllevakdsiprshwkktpvvlkataglrllpehkakallfevkeifrkspflvpkgsvsimdgsdegilawvtvnfltgqlhghrqetvgtl
Additional Information
| SKU | 10292456 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB28613 |
