Elf4/MEF Recombinant Protein Antigen, Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition, Each

Details

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Elf4/MEF. Source: E.coli Amino Acid Sequence: TDDNEATSHTMSTAEVLLNMESPSDILDEKQIFSTSEMLPDSDPAPAVTLPNYLFPASEPDALNRAGDTSDQEGHSLEEKASREESAKKT The Elf4/MEF Recombinant Protein Antigen is derived from E. coli. The Elf4/MEF Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.