518-831-8000 sales@utechproducts.com

Efnb3, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Efnb3, Each

1,750.95

Details

Efnb3, a member of the ephrin gene family, is important in brain development as well as in its maintenance. Moreover, since levels of efnb3 expression were particularly high in several forebrain subregions compared to other brain subregions, it may play a pivotal role in forebrain function. The eph and eph-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, particularly in the nervous system. Eph receptors typically have a single kinase domain and an extracellular region containing a cys-rich domain and 2 fibronectin type iii repeats. The ephrin ligands and receptors have been named by the eph nomenclature committee (1997). Based on their structures and sequence relationships, ephrins are divided into the ephrin-a (efna) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-b (efnb) class, which are transmembrane proteins. The eph family of receptors are similarly divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-a and ephrin-b ligands. [Provided by refseqsequence: hsspnyefyklylvggaqgrrceappapnllltcdrpdldlrftikfqeyspnlwghefrshhdyyiiatsdgtregleslqggvcltrgmkvllrvgqsprggavprkpvsempmerdrgaahslepgkenlpgdptsnats

Additional Information

SKU 10286445
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20075