Dnajc25-Gng10, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Dnajc25-Gng10, Each
$ 1,757.70
|
|
Details
This gene represents naturally-occurring mrnas that are co-transcribed products of the neighboring dnajc25 and gng10 genes. These transcripts include the first exon of dnajc25 and the last two exons of gng10, resulting in a protein that combines the n-terminus of dnajc25 and the c-terminus of gng10. [Provided by refseqsequence: nikgkeygeeerlyiirksmkmsksqfdsledhqketflkrelwikenyevykqeqeeelkkklandprwkryrrwmknegpgrltfvdd
Additional Information
| SKU | 10291700 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB27473 |
