Dnajc24 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Dnajc24, Each
$ 1,757.70
|
|
Details
Diphthamide is a unique posttranslationally modified histidine found only in translation elongation factor-2 (eef2; mim 130610). This modification is conserved from archaebacteria to humans and serves as the target for adp-ribosylation and inactivation of eef2 by diphtheria toxin (dt) and pseudomonas exotoxin a. Dph4 is 1 of several enzymes involved in synthesis of diphthamide in eef2 (liu et al., 2004 [Pubmed 15485916]).[Supplied by omimsequence: lqrceddlrnvgpvdaqvyleemswnegdhsfylscrcggkysvskdeaeevsliscdtcsliiellhy
Additional Information
| SKU | 10287934 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB21766 |
