Dnah8, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Dnah8, Each
|
|
Details
Dyneins are microtubule-associated motor protein complexes composed of several heavy, light, and intermediate chains. Dynein heavy chains (dhcs) are responsible for force production and atpase activity and contain a highly conserved catalytic domain with 4 p-loop consensus motifs involved in nucleotide binding. Two major classes of dyneins, axonemal and cytoplasmic, have been identified. Axonemal dyneins, found in cilia and flagella, are components of the outer and inner dynein arms attached to the peripheral microtubule doublets. Dnah8 is an outer arm axonemal dhc (chapelin et al., 1997 [Pubmed 9256245]; neesen et al., 1997 [Pubmed 9373155]).[Supplied by omimsequence: ilnhkskhveeavrelisifeqiyevkytgkvgkqseqrkhvvfgseteegenndyeanivnefdthdkedefkkeckevfaffshqlldslqkatrlsld
Additional Information
| SKU | 10288259 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB22154 |
