518-831-8000 sales@utechproducts.com

Dhx34 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Dhx34, Each

1,757.70

Details

Dead box proteins, characterized by the conserved motif asp-glu-ala-asp (dead), are putative rna helicases. They are implicated in a number of cellular processes involving alteration of rna secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this dead box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a member of this family. It is mapped to the glioma 19q tumor suppressor region and is a tumor suppressor candidate gene. [Provided by refseqsequence: gvcfrlyaesdydafapypvpeirrvaldslvlqmksmsvgdprtfpfieppppasletailylrdqgaldssealtpigsllaqlpvdvv

Additional Information

SKU 10292060
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28134