Dgcr2, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Dgcr2, Each
$ 1,757.70
|
|
Details
Deletions of the 22q11.2 Have been associated with a wide range of developmental defects (notably digeorge syndrome, velocardiofacial syndrome, conotruncal anomaly face syndrome and isolated conotruncal cardiac defects) classified under the acronym catch 22. The dgcr2 gene encodes a novel putative adhesion receptor protein, which could play a role in neural crest cells migration, a process which has been proposed to be altered in digeorge syndrome. [Provided by refseqsequence: rfsrkcptgwhhyegtascyrvylsgenywdaaqtcqrlngslatfstdqelrfvlaqewdqpersfgwkdqrklwvgyqyvitgrnrslegrwevafkgssevflppdpifasamsendnvfcaqlqcfhfptlrhhdlhswhaescyekssflckrsqtcvdikdnvvdegfyftpk
Additional Information
| SKU | 10287320 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB21078 |
