DEFB125, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant DEFB125, Each
$ 1,069.20
|
|
Details:
Defensins are cysteine-rich cationic polypeptides that are important in the host immunologic response to invading microorganisms. The protein encoded by this gene is secreted and is a member of the beta defensin protein family. Beta defensin genes are found in several clusters throughout the genome, with this gene mapping to a cluster at 20p13. [provided by RefSeqSequence: PVSMLNDLITFDTTKFGETMTPETNTPETTMPPSEATTPETTMPPSETATSETMPPPSQTALTHN
Additional Information
| SKU | 10289866 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB24006 |
