Dctn5, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Dctn5, Each
$ 1,757.70
|
|
Details
Dynactin (see mim 601143) is a multimeric protein essential for minus-end-directed transport driven by the microtubule-based motor dynein (see dync1h1; mim 600112). Dctn5 is a subunit of the pointed-end subcomplex of dynactin that is thought to interact with membranous cargo (parisi et al., 2004 [Pubmed 15043994]).[Supplied by omimsequence: lgellynkseyietasgnkvsrqsvlcgsqnivlngktivmndciirgdlanvrvgrhcvvksrsvirppfkkfskgv
Additional Information
| SKU | 10289770 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB23889 |
