Cytip, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Cytip, Each
$ 1,757.70
|
|
Details
The protein encoded by this gene contains 2 leucine zipper domains and a putative c-terminal nuclear targeting signal, but does not have any hydrophobic regions. This protein is expressed weakly in resting nk and t cells. The encoded protein modulates the activation of arf genes by cyth1. This protein interacts with cyth1 and snx27 proteins and may act to sequester cyth1 protein in the cytoplasm.[Provided by refseqsequence: payssystltgsltmddnrriqmladtvatlprgrkqlaltrssslsdfswsqrklvtvekqdnetfgfeiqsyrpqnqnacssemftlickiqedspahcaglqagdvlaningvstegf
Additional Information
| SKU | 10286701 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB20364 |
