COX6B1 (M01A), Mouse anti-Human, Clone: 5D3, Abnova, Mouse monoclonal antibody raised against a partial recombinant COX6B1, Each
 
                                
                            
                        
                            
                            
                            
                                Call For Price
                            
                            
                        
                        
                        
                        
                            Details
Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes subunit VIb. Three pseudogenes COX6BP-1, COX6BP-2 and COX6BP-3 have been found on chromosomes 7, 17 and 22q13.1-13.2, respectively. [provided by RefSeqSequence: MAEDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWVTDWDEQRAEGTFPGKI
Additional Information
| SKU | 10006439 | 
|---|---|
| UOM | Each | 
| UNSPSC | 12352200 | 
| Manufacturer Part Number | H00001340M01A | 
 
                            