Cox19 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Cox19, Each
$ 1,757.70
|
|
Details
Cox19 encodes a cytochrome c oxidase (cox)-assembly protein. The s. Cerevisiae cox19 protein may play a role in metal transport to the mitochondrial intermembrane space and assembly of complex iv of the mitochondrial respiratory chain (sacconi et al., 2005 [Pubmed 16212937]).[Supplied by omimsequence: nfgtksfqprppdkgsfpldhlgecksfkekfmkclhnnnfenalcrkeskeylecrmerklmlqepleklgfgd
Additional Information
| SKU | 10287574 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB21370 |
