Coro2a Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Coro2a, Each
|
|
Details
This gene encodes a member of the wd repeat protein family. Wd repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (gh-wd), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This protein contains 5 wd repeats, and has a structural similarity with actin-binding proteins: the d. Discoideum coronin and the human p57 protein, suggesting that this protein may also be an actin-binding protein that regulates cell motility. Alternative splicing of this gene generates 2 transcript variants. [Provided by refseqsequence: diypptagaqpsltaqewlsgmnrdpilvslrpgsellrphplpaerpifnsmapasprllnqteklaaedgw
Additional Information
| SKU | 10289650 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB23759 |
