518-831-8000 sales@utechproducts.com

Coq9, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Coq9, Each

1,757.70

Details

Coenzyme q10 (coq10), or ubiquinone, is a mobile lipophilic electron carrier critical for electron transfer by the mitochondrial inner membrane respiratory chain. Coq9 is 1 of several enzymes involved in biosynthesis of coq10 and likely functions in modification of the benzoquinone ring (duncan et al., 2009 [Pubmed 19375058]).[Supplied by omimsequence: dqstdfnwytrramlaaiynttelvmmqdsspdfedtwrflenrvndamnmghtakqvkstgealvqglmgaavtlknl

Additional Information

SKU 10289608
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23716