518-831-8000 sales@utechproducts.com

Cntn2, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Cntn2, Each

1,757.70

Details

The protein encoded by this gene is a member of the immunoglobulin superfamily. It is a glycosylphosphatidylinositol (gpi)-anchored neuronal membrane protein that functions as a cell adhesion molecule. It may play a role in the formation of axon connections in the developing nervous system. It may also be involved in glial tumorigenesis and may provide a potential target for therapeutic intervention. [Provided by refseqsequence: paspsanattmkppprrppgniswtfsssslsikwdpvvpfrnesavtgykmlyqndlhltptlhltgknwieipvpedighalvqirttgpggdgipaevhivrnggtsmmvenmavrpaphpgtvishsvamlil

Additional Information

SKU 10292311
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28428