Clic4, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Clic4, Each
$ 1,757.70
|
|
Details
Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular ph, and regulation of cell volume. Chloride intracellular channel 4 (clic4) protein, encoded by the clic4 gene, is a member of the p64 family; the gene is expressed in many tissues and exhibits a intracellular vesicular pattern in panc-1 cells (pancreatic cancer cells). [Provided by refseqsequence: thppfitfnsevktdvnkieefleevlcppkylklspkhpesntagmdifakfsayiknsrpeanealergllktlqkldeylnsplpdeidensmedikfstrkfldgnemtladcnllpklhivkvvakkyrnfdipkemtgi
Additional Information
| SKU | 10286738 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB20406 |
