Chuk Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Chuk, Each
$ 1,420.20
|
|
Details
This gene encodes a member of the serine/threonine protein kinase family. The encoded protein, a component of a cytokine-activated protein complex that is an inhibitor of the essential transcription factor nf-kappa-b complex, phosphorylates sites that trigger the degradation of the inhibitor via the ubiquination pathway, thereby activating the transcription factor. [Provided by refseqsequence: htvqsqdrvlkelfghlskllgckqkiidllpkvevalsnikeadntvmfmqgkrqkeiwhllkiactqssarslvgsslegavtpqtsawlpptsaehdhslscvvtpqdgetsaqmieenlnclghlstiiheaneeqgnsmmn
Additional Information
| SKU | 10292314 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB28431 |
