Chd1l Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Chd1l, Each
$ 1,757.70
|
|
Details
In response to dna strand breaks, chromatin adopts a relaxed structure due to the addition of poly(adp-ribose) (par) to chromatin proteins by parp enzymes (see parp1; mim 173870), and this relaxation facilitates the repair of dna damage. Chd1l interacts with par and has a role in chromatin relaxation following dna damage (ahel et al., 2009 [Pubmed 19661379]).[Supplied by omimsequence: gsrdqeegknhmylfegkdyskepskedrksfeqlvnlqktllekasqegrslrnkgsvlipglvegstkrkrvlspeeledrqkkrqeaaakrrrlieekkr
Additional Information
| SKU | 10288303 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB22203 |
