518-831-8000 sales@utechproducts.com

Cdca7 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Cdca7, Each

1,069.20

Details

This gene was identified as a c-myc responsive gene, and behaves as a direct c-myc target gene. Overexpression of this gene is found to enhance the transformation of lymphoblastoid cells, and it complements a transformation-defective myc box ii mutant, suggesting its involvement in c-myc-mediated cell transformation. Two alternatively spliced transcript variants encoding distinct isoforms have been reported. [Provided by refseqsequence: pkfrsdiseelanvfyedsdnesfcgfsesevqdvldhcgflqkprpdvtnelagifhadsddesfcgfseseiqdgm

Additional Information

SKU 10287339
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21100