Cdc26, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Cdc26, Each
$ 1,757.70
|
|
Details
The protein encoded by this gene is highly similar to saccharomyces cerevisiae cdc26, a component of cell cycle anaphase-promoting complex (apc). Apc is composed of a group of highly conserved proteins and functions as a cell cycle-regulated ubiquitin-protein ligase. Apc thus is responsible for the cell cycle regulated proteolysis of various proteins. [Provided by refseqsequence: mlrrkptrlelklddieefenirkdletrkkqkedvevvggsdgegaiglssdpksreqmindrigykpqpkpnnrssqfgsl
Additional Information
| SKU | 10289988 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB24297 |
