518-831-8000 sales@utechproducts.com

Card10 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Card10, Each

1,318.98

Details

The caspase recruitment domain (card) is a protein module that consists of 6 or 7 antiparallel alpha helices. It participates in apoptosis signaling through highly specific protein-protein homophilic interactions. Like several other card proteins, card10 belongs to the membrane-associated guanylate kinase (maguk) family and activates nf-kappa-b (nfkb; see mim 164011) through bcl10 (mim 603517) (wang et al., 2001 [Pubmed 11259443]).[Supplied by omimsequence: rldfqvcpaeslsgeelcpssapgapkaqpatpglgsriraiqesvgkkhcllelgargvrelvqneiypivihvevteknvrevrgll

Additional Information

SKU 10288364
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22274