C8b, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant C8b, Each
$ 1,757.70
|
|
Details
C8 beta is one of the three subunits that comprise the component 8 (c8) of the complement system. C8 participates in the formation of membrane attack complex that results in the lysis of cells. Patients with c8b deficiency are prone to bacteria infection. [Provided by refseqsequence: pcqgngvpvlkgsrcdcicpvgsqglacevsyrkntpidgkwncwsnwsscsgrrktrqrqcnnpppqnggspcsgpasetldcs
Additional Information
| SKU | 10287781 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB21600 |
