518-831-8000 sales@utechproducts.com

C6orf190, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant C6orf190, Each

1,757.70

Details

This gene encodes a protein that plays a regulatory role in both positive and negative t-cell selection during late thymocyte development. The protein functions through t-cell antigen receptor signaling, and is necessary for proper lineage commitment and maturation of t-cells. Alternative splicing results in multiple transcript variants. [Provided by refseqsequence: egceslqpfelpmnfpglfkivadktpyltmeeitrtihigpsrlghpcfyhqkdiklenliikqgeqimlnsveeidgeimvscavarnhqthsf

Additional Information

SKU 10288797
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22780