518-831-8000 sales@utechproducts.com

C1qc, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant C1qc, Each

1,757.70

Details

This gene encodes a major constituent of the human complement subcomponent c1q. C1q associates with c1r and c1s in order to yield the first component of the serum complement system. A deficiency in c1q has been associated with lupus erythematosus and glomerulonephritis. C1q is composed of 18 polypeptide chains: six a-chains, six b-chains, and six c-chains. Each chain contains a collagen-like region located near the n-terminus, and a c-terminal globular region. The a-, b-, and c-chains are arranged in the order a-c-b on chromosome 1. This gene encodes the c-chain polypeptide of human complement subcomponent c1q. Alternatively spliced transcript variants that encode the same protein have been found for this gene. [Provided by refseqsequence: gipgepgeegrykqkfqsvftvtrqthqppapnslirfnavltnpqgdydtstgkftckvpglyyfvyhashtanlcvllyrsgvkvvtfcghtsktnqvnsggvllrlqvgeevwlavndyydmvgiqgsd

Additional Information

SKU 10292321
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28439