C19orf40 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant C19orf40, Each
$ 1,757.70
|
|
Details
Faap24 is a component of the fanconi anemia (fa) core complex (see mim 227650), which plays a crucial role in dna damage response (ciccia et al., 2007 [Pubmed 17289582]).[Supplied by omimsequence: vldlgmvllpvasqmeasclviqlvqeqtkepsknpllgkkralllsepsllrtvqqipgvgkvkaplllqkfpsiqqlsnasigeleqvvgqavaqq
Additional Information
| SKU | 10291940 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB27898 |
