Animal Research
BioPharmaceutical
Chemicals
Construction Components & Supplies
Domestic Supplies
Electrical Equipments & Accessories
Electronic Components
Furniture
General Laboratory Equipments
General Machinery
Industrial Equipments & Accessories
Land surveying instruments
Manufacturing Supplies
Mechanical instruments
Medical Equipment and Supplies
Mineral, Ores & Metals
Office Supplies
Others
Paper Products
Personal Care & Safety
Primers and linkers and adaptors
Printing Equipments & Supplies
Pumps & Tubing
School Supplies
Signs & Labels
Transportation Equipments & Supplies
Workspace Essentials
518-831-8000 [email protected]
Log In / Signup
Utech Products Inc.
Log In / Signup My Cart 0
Contact Us

C14orf119, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant C14orf119, Each

$ 1,757.70

Details

Sequence: sllpsvphntnpspplmsyitsqemkcilhwfanwsgpqrerfledlvakavpeklqplldsleqlsvsgadrppsifecqlhlwdqwfrgwaeqernefvrqlefsepdfvakfyq

Additional Information

SKU 10286594
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20233