C12orf30, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant C12orf30, Each
$ 1,757.70
|
|
Details
Mdm20 is a component of n-acetyltransferase complex b (natb). Human natb performs cotranslational n(alpha)-terminal acetylation of methionine residues when they are followed by asparagine (starheim et al., 2008 [Pubmed 18570629]).[Supplied by omimsequence: tgkrfiekdiqypflgpvptrmggffnsgcsqcqissfylvndiyeldtsgledtmeiqeriensfkslldqlkdvfskckgdll
Additional Information
| SKU | 10289336 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB23412 |
