Brd8 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Brd8, Each
$ 1,757.70
|
|
Details
The protein encoded by this gene interacts with thyroid hormone receptor in a ligand-dependent manner and enhances thyroid hormone-dependent activation from thyroid response elements. This protein contains a bromodomain and is thought to be a nuclear receptor coactivator. Three alternatively spliced transcript variants that encode distinct isoforms have been identified. [Provided by refseqsequence: easpesmlspshgsnpiedpleaetqhkfemsdslkeesgtifgsqikdapgedeeedgvseaasleepkeedqgegylsemdneppvsesddgfsihnatlqshtladsipsspassqfsvcsedqeaiqaqkiwkkaimlvwraa
Additional Information
| SKU | 10292370 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB28491 |
