518-831-8000 sales@utechproducts.com

Bloc1s1, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Bloc1s1, Each

1,757.70

Details

Bloc1s1 is a component of the ubiquitously expressed bloc1 multisubunit protein complex. Bloc1 is required for normal biogenesis of specialized organelles of the endosomal-lysosomal system, such as melanosomes and platelet dense granules (starcevic and dell'angelica, 2004 [pubmed 15102850]).[Supplied by omimsequence: llkehqakqnerkelqekrrreaitaatcltealvdhlnvgvaqaymnqrkldhevktlqvqaaqfakqtgqwigmvenfnqalkeigdvenwarsieldmrtiataleyvykgq

Additional Information

SKU 10287601
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21399