Bloc1s1, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Bloc1s1, Each
$ 1,757.70
|
|
Details
Bloc1s1 is a component of the ubiquitously expressed bloc1 multisubunit protein complex. Bloc1 is required for normal biogenesis of specialized organelles of the endosomal-lysosomal system, such as melanosomes and platelet dense granules (starcevic and dell'angelica, 2004 [pubmed 15102850]).[Supplied by omimsequence: llkehqakqnerkelqekrrreaitaatcltealvdhlnvgvaqaymnqrkldhevktlqvqaaqfakqtgqwigmvenfnqalkeigdvenwarsieldmrtiataleyvykgq
Additional Information
| SKU | 10287601 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB21399 |
