Bcl7a, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Bcl7a, Each
$ 1,757.70
|
|
Details
This gene is directly involved, with myc and igh, in a three-way gene translocation in a burkitt lymphoma cell line. As a result of the gene translocation, the n-terminal region of the gene product is disrupted, which is thought to be related to the pathogenesis of a subset of high-grade b cell non-hodgkin lymphoma. The n-terminal segment involved in the translocation includes the region that shares a strong sequence similarity with those of bcl7b and bcl7c. Two transcript variants encoding different isoforms have been found for this gene. [Provided by refseqsequence: qadgkehpgaedasdeqnsqssmehsmnssekvdrqpsgdsglaaetsaisqdlegvppskkmkleasqqnse
Additional Information
| SKU | 10292014 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB28020 |
