B4galnt2, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant B4galnt2, Each
$ 1,757.70
|
|
Details
B4galnt2 catalyzes the last step in the biosynthesis of the human sd(a) antigen through the addition of an n-acetylgalactosamine residue via a beta-1,4 linkage to a subterminal galactose residue substituted with an alpha-2,3-linked sialic acid. B4galnt2 also catalyzes the last step in the biosynthesis of the cad antigen (montiel et al., 2003 [Pubmed 12678917]).[Supplied by omimsequence: llpeerlrnlfsydgiwlfpknqckceankeqggynfqdaygqsdlpavkarrqaefehfqrreglprplpllvqpnlpfgypvhgvevmplhtvpipglqfegpda
Additional Information
| SKU | 10287117 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB20841 |
