Arl4c, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Arl4c, Each
$ 1,757.70
|
|
Details
Adp-ribosylation factor-like 4c is a member of the adp-ribosylation factor family of gtp-binding proteins. Arl4c is closely similar to arl4a and arl4d and each has a nuclear localization signal and an unusually high guanine nucleotide exchange rate. This protein may play a role in cholesterol transport. [Provided by refseqsequence: giiyvvdsvdvdrleeaktelhkvtkfaenqgtpllviankqdlpkslpvaeiekqlalhelipattyhvqpacaiigegltegmdklyemilkrrkslkqkkkr
Additional Information
| SKU | 10288323 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB22227 |
