518-831-8000 sales@utechproducts.com

Arid4b Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Arid4b, Each

$ 1,757.70

Details

This gene encodes a protein with sequence similarity to retinoblastoma-binding protein-1. The encoded protein is a subunit of the histone deacetylase-dependant sin3a transcriptional corepressor complex, which functions in diverse cellular processes including proliferation, differentiation, apoptosis, oncogenesis, and cell fate determination. The gene product is recognized by igg antibody isolated from a breast cancer patient and appears to be a molecular marker associated with a broad range of human malignancies. Alternate transcriptional splice variants encoding different isoforms have been characterized. [Provided by refseqsequence: dnngkeeskidhltnnrndliskeeqnssslleenkvhadlviskpvsksperlrkdievlsedtdyeedevtkkrkdvkkdttdksskpqikrgkr

Additional Information

SKU 10288043
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21892