Arhgap27, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Arhgap27, Each
$ 1,757.70
|
|
Details
Rho (see arha; mim 165390)-like small gtpases are involved in many cellular processes, and they are inactive in the gdp-bound state and active in the gtp-bound state. Gtpase-activating proteins, such as arhgap27, inhibit rho-like proteins by stimulating their intrinsic gtpase activity (katoh and katoh, 2004 [pubmed 15492870]).[Supplied by omimsequence: wtvleggvltffkdsktsaagglrqpskfstpeytvelrgatlswapkdkssrknvlelrsrdgseyliqhdseaiistwhkaiaqgiqe
Additional Information
| SKU | 10287805 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB21625 |
